- Schlafen 11 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Supplier Product Page
- NBP1-92368
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: REVLGCAKEN VDPDSLRRKI EQAIYKLPCV HFCQPQRPIT FTLKIVDVLK RGELYGYACM IRVNPFCCAV FSEAPNSWI
- Rabbit
- 0.1 ml (also 25ul)
- Unconjugated
- SLFN8/9
- Schlafen 11
- Human
- schlafen family member 11
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
REVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVDVLKRGELYGYACMIRVNPFCCAVFSEAPNSWI
Specifications/Features
Available conjugates: Unconjugated